Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
Protein automated matches [191077] (2 species) not a true protein |
Species Escherichia coli [TaxId:83333] [195877] (4 PDB entries) |
Domain d3t4hb_: 3t4h B: [195878] automated match to d2fdja_ complexed with epe, fe, md5 |
PDB Entry: 3t4h (more details), 1.65 Å
SCOPe Domain Sequences for d3t4hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t4hb_ b.82.2.10 (B:) automated matches {Escherichia coli [TaxId: 83333]} plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk agfhpltidcrynltfrqagk
Timeline for d3t4hb_: