Lineage for d3t2ua1 (3t2u A:1-77)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855550Species Wuchereria bancrofti [TaxId:6293] [226429] (1 PDB entry)
  8. 1855551Domain d3t2ua1: 3t2u A:1-77 [216650]
    Other proteins in same PDB: d3t2ua2, d3t2ub2
    automated match to d1tu7a2
    complexed with gsh

Details for d3t2ua1

PDB Entry: 3t2u (more details), 2.3 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3t2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2ua1 c.47.1.0 (A:1-77) automated matches {Wuchereria bancrofti [TaxId: 6293]}
msykltyfpirglaepirlvlvdqgikftddrinasdwpsmkshfhfgqlpclydgdhqi
vqsgailrhlarkhnln

SCOPe Domain Coordinates for d3t2ua1:

Click to download the PDB-style file with coordinates for d3t2ua1.
(The format of our PDB-style files is described here.)

Timeline for d3t2ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t2ua2