| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (147 species) not a true protein |
| Species Wuchereria bancrofti [TaxId:6293] [226429] (1 PDB entry) |
| Domain d3t2ua1: 3t2u A:1-77 [216650] Other proteins in same PDB: d3t2ua2, d3t2ub2 automated match to d1tu7a2 complexed with gsh |
PDB Entry: 3t2u (more details), 2.3 Å
SCOPe Domain Sequences for d3t2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2ua1 c.47.1.0 (A:1-77) automated matches {Wuchereria bancrofti [TaxId: 6293]}
msykltyfpirglaepirlvlvdqgikftddrinasdwpsmkshfhfgqlpclydgdhqi
vqsgailrhlarkhnln
Timeline for d3t2ua1: