Lineage for d3t0xa_ (3t0x A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365873Domain d3t0xa_: 3t0x A: [216631]
    automated match to d2e7lc_
    complexed with diw, edo, so4

Details for d3t0xa_

PDB Entry: 3t0x (more details), 1.96 Å

PDB Description: fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red
PDB Compounds: (A:) Immunoglobulin variable lambda domain M8VLA4(S55P)

SCOPe Domain Sequences for d3t0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t0xa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrpsgvp
drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvld

SCOPe Domain Coordinates for d3t0xa_:

Click to download the PDB-style file with coordinates for d3t0xa_.
(The format of our PDB-style files is described here.)

Timeline for d3t0xa_: