Lineage for d3szil_ (3szi L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1801299Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1801300Protein automated matches [190537] (8 species)
    not a true protein
  7. 1801337Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 1801359Domain d3szil_: 3szi L: [200738]
    automated match to d3szig_
    complexed with fmt

Details for d3szil_

PDB Entry: 3szi (more details), 1.4 Å

PDB Description: Structure of apo shwanavidin (P21 form)
PDB Compounds: (L:) Avidin/streptavidin

SCOPe Domain Sequences for d3szil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szil_ b.61.1.0 (L:) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqtsa

SCOPe Domain Coordinates for d3szil_:

Click to download the PDB-style file with coordinates for d3szil_.
(The format of our PDB-style files is described here.)

Timeline for d3szil_: