Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (8 species) not a true protein |
Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries) |
Domain d3szig_: 3szi G: [195526] automated match to d1kl4b_ complexed with fmt |
PDB Entry: 3szi (more details), 1.4 Å
SCOPe Domain Sequences for d3szig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3szig_ b.61.1.0 (G:) automated matches {Shewanella denitrificans [TaxId: 318161]} amaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtai sfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
Timeline for d3szig_: