Lineage for d3szig_ (3szi G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1801299Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1801300Protein automated matches [190537] (8 species)
    not a true protein
  7. 1801337Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 1801354Domain d3szig_: 3szi G: [195526]
    automated match to d1kl4b_
    complexed with fmt

Details for d3szig_

PDB Entry: 3szi (more details), 1.4 Å

PDB Description: Structure of apo shwanavidin (P21 form)
PDB Compounds: (G:) Avidin/streptavidin

SCOPe Domain Sequences for d3szig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3szig_ b.61.1.0 (G:) automated matches {Shewanella denitrificans [TaxId: 318161]}
amaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtai
sfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

SCOPe Domain Coordinates for d3szig_:

Click to download the PDB-style file with coordinates for d3szig_.
(The format of our PDB-style files is described here.)

Timeline for d3szig_: