Lineage for d3szba_ (3szb A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.82: ALDH-like [53719] (1 superfamily)
consists of two similar domains with 3 layers (a/b/a) each; duplication
core: parallel beta-sheet of 5 strands, order 32145Superfamily c.82.1: ALDH-like [53720] (3 families) 
binds NAD differently from other NAD(P)-dependent oxidoreductases
Family c.82.1.1: ALDH-like [53721] (6 proteins) Protein automated matches [190401] (5 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189906] (28 PDB entries) 
Domain d3szba_: 3szb A: [185595]
automated match to d1ad3a_
complexed with act, i1e, k
Details for d3szba_
PDB Entry: 3szb (more details), 1.51 Å
PDB Description: crystal structure of human aldh3a1 modified with the beta-elimination product of aldi-1; 1-phenyl- 2-propen-1-one
PDB Compounds: (A:) aldehyde dehydrogenaseSCOPe Domain Sequences for d3szba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3szba_ c.82.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skiseavkraraafssgrtrplqfriqqlealqrliqeqeqelvgalaadlhknewnayy
eevvyvleeieymiqklpewaadepvektpqtqqdelyihseplgvvlvigtwnypfnlt
iqpmvgaiaagnavvlkpselsenmasllatiipqyldkdlypvinggvpettellkerf
dhilytgstgvgkiimtaaakhltpvtlelggkspcyvdkncdldvacrriawgkfmnsg
qtcvapdyilcdpsiqnqiveklkkslkefygedakksrdygriisarhfqrvmgliegq
kvayggtgdaatryiaptiltdvdpqspvmqeeifgpvlpivcvrsleeaiqfinqrekp
lalymfssndkvikkmiaetssggvaandvivhitlhslpfggvgnsgmgsyhgkksfet
fshrrsclvrplmndeglkvryppspa
SCOPe Domain Coordinates for d3szba_:
Click to download the PDB-style file with coordinates for d3szba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3szba_:
- d3szba_ first appeared in SCOPe 2.01
- d3szba_ appears in SCOPe 2.07
View in 3D
