Lineage for d3sz3a_ (3sz3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841582Protein automated matches [190581] (8 species)
    not a true protein
  7. 1841618Species Vibrio cholerae [TaxId:243277] [196171] (1 PDB entry)
  8. 1841619Domain d3sz3a_: 3sz3 A: [196172]
    automated match to d3n9ia_
    complexed with gol, trp

Details for d3sz3a_

PDB Entry: 3sz3 (more details), 1.5 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase from vibrio cholerae with an endogenous tryptophan
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3sz3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sz3a_ c.26.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
snamskpivlsgvqpsgelsignylgalrqwqqmqddydcqycvvdlhaitvrqdpqalh
eatldalaiclavgvdpkkstlfvqshvpehaqlgwvlncytqmgelsrmtqfkdksary
andvnaglfgypvlmaadillygahqvpvgsdqkqhlelardiatrfnniyspeqpifti
pepyiptvnarvmslqdatkkmsksddnrknvitlledpksiikkinkaqtdaetppria
ydvenkagianlmglysaatgktfaeieaqyagvemygpfkkdvgeavvamlepvqaeyq
rirndreylnsvmrdgaekasakalqtlkkvyaavgfvarp

SCOPe Domain Coordinates for d3sz3a_:

Click to download the PDB-style file with coordinates for d3sz3a_.
(The format of our PDB-style files is described here.)

Timeline for d3sz3a_: