![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Artificial gene [TaxId:32630] [189424] (7 PDB entries) |
![]() | Domain d3svod_: 3svo D: [193639] automated match to d3bx9a_ mutant |
PDB Entry: 3svo (more details), 1.98 Å
SCOPe Domain Sequences for d3svod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3svod_ d.22.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]} alitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf mygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir gvnfpsngpvmqkktlgweactemlypadgglegradmalklvggghlicnlkttyrskk paknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpsklahk
Timeline for d3svod_: