Lineage for d3svna_ (3svn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940244Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 2940257Domain d3svna_: 3svn A: [200703]
    automated match to d3svnd_
    mutant

Details for d3svna_

PDB Entry: 3svn (more details), 1.9 Å

PDB Description: Crystal structure of mKate S158A mutant at pH 7.5
PDB Compounds: (A:) mKate

SCOPe Domain Sequences for d3svna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svna_ d.22.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
aaasmsalitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafd
ilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcli
ynvkirgvnfpsngpvmqkktlgweastemlypadgglegradmalklvggghlicnlkt
tyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpsklahk

SCOPe Domain Coordinates for d3svna_:

Click to download the PDB-style file with coordinates for d3svna_.
(The format of our PDB-style files is described here.)

Timeline for d3svna_: