Lineage for d3ssra_ (3ssr A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.56: CcmK-like [143414] (2 families) 
contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shapeFamily d.58.56.1: CcmK-like [143415] (4 proteins)
Pfam PF00936; BMC domain
Protein automated matches [191074] (7 species)
not a true protein
Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries) 
Domain d3ssra_: 3ssr A: [194975]
automated match to d2a1ba1
complexed with so4
Details for d3ssra_
PDB Entry: 3ssr (more details), 1.6 Å
PDB Description: ccmk2 dodecamer - form 2
PDB Compounds: (A:) Carbon dioxide concentrating mechanism proteinSCOPe Domain Sequences for d3ssra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ssra_ d.58.56.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
iavgmietrgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagvd
sakrvnggevlsthiiarphenleyvlpiryteaveqfr
SCOPe Domain Coordinates for d3ssra_:
Click to download the PDB-style file with coordinates for d3ssra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ssra_:
- d3ssra_ first appeared in SCOPe 2.02
- d3ssra_ appears in SCOPe 2.07
View in 3D
