Lineage for d3srxa_ (3srx A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.0: automated matches [191360] (1 protein)
not a true familyProtein automated matches [190418] (8 species)
not a true proteinSpecies Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries) 
Domain d3srxa_: 3srx A: [185503]
automated match to d1ko2a_
complexed with cd, cl, gol, scn
Details for d3srxa_
PDB Entry: 3srx (more details), 2.5 Å
PDB Description: New Delhi Metallo-beta-Lactamase-1 Complexed with Cd
PDB Compounds: (A:) Beta-lactamase NDM-1SCOPe Domain Sequences for d3srxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3srxa_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
snanymetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
SCOPe Domain Coordinates for d3srxa_:
Click to download the PDB-style file with coordinates for d3srxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3srxa_:
- d3srxa_ first appeared in SCOPe 2.01
- d3srxa_ appears in SCOPe 2.02
- d3srxa_ appears in SCOPe 2.04
- d3srxa_ appears in the current release, SCOPe 2.08, called d3srxa1
View in 3D
