Lineage for d3srxa_ (3srx A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440394Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1440395Protein automated matches [190418] (8 species)
    not a true protein
  7. 1440403Species Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries)
  8. 1440431Domain d3srxa_: 3srx A: [185503]
    automated match to d1ko2a_
    complexed with cd, cl, gol, scn

Details for d3srxa_

PDB Entry: 3srx (more details), 2.5 Å

PDB Description: New Delhi Metallo-beta-Lactamase-1 Complexed with Cd
PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3srxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3srxa_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
snanymetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d3srxa_:

Click to download the PDB-style file with coordinates for d3srxa_.
(The format of our PDB-style files is described here.)

Timeline for d3srxa_: