Lineage for d3sq6a_ (3sq6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819914Species Human (Homo sapiens) [TaxId:9606] [189722] (4 PDB entries)
  8. 2819925Domain d3sq6a_: 3sq6 A: [185478]
    automated match to d1uw6a_
    complexed with epj, nag

Details for d3sq6a_

PDB Entry: 3sq6 (more details), 2.8 Å

PDB Description: crystal structures of the ligand binding domain of a pentameric alpha7 nicotinic receptor chimera with its agonist epibatidine
PDB Compounds: (A:) Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein

SCOPe Domain Sequences for d3sq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sq6a_ b.96.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
erfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d3sq6a_:

Click to download the PDB-style file with coordinates for d3sq6a_.
(The format of our PDB-style files is described here.)

Timeline for d3sq6a_: