Lineage for d3spka_ (3spk A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (9 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
Domain d3spka_: 3spk A: [185474]
automated match to d1rpia_
complexed with tpv
Details for d3spka_
PDB Entry: 3spk (more details), 1.24 Å
PDB Description: Tipranavir in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
PDB Compounds: (A:) hiv-1 proteaseSCOPe Domain Sequences for d3spka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3spka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
SCOPe Domain Coordinates for d3spka_:
Click to download the PDB-style file with coordinates for d3spka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3spka_:
- d3spka_ first appeared in SCOPe 2.01
- d3spka_ appears in SCOPe 2.07
View in 3D
