| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein automated matches [190085] (59 species) not a true protein |
| Species Streptomyces griseoruber [TaxId:1943] [196180] (1 PDB entry) |
| Domain d3sjub_: 3sju B: [196181] automated match to d2rhcb_ complexed with ndp |
PDB Entry: 3sju (more details), 2.4 Å
SCOPe Domain Sequences for d3sjub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sjub_ c.2.1.2 (B:) automated matches {Streptomyces griseoruber [TaxId: 1943]}
qtafvtgvssgiglavartlaargiavygcardaknvsaavdglraaghdvdgsscdvts
tdevhaavaaaverfgpigilvnsagrngggetadlddalwadvldtnltgvfrvtrevl
raggmreagwgrivniastggkqgvmyaapytaskhgvvgftksvgfelaktgitvnavc
pgyvetpmaervregyarhwgvteqevherfnakiplgrystpeevaglvgylvtdaaas
itaqalnvcgglgny
Timeline for d3sjub_: