Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins) |
Protein automated matches [190398] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [196246] (1 PDB entry) |
Domain d3sird_: 3sir D: [196247] automated match to d1m72c_ |
PDB Entry: 3sir (more details), 2.68 Å
SCOPe Domain Sequences for d3sird_:
Sequence, based on SEQRES records: (download)
>d3sird_ c.17.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aaeynmrhknrgmalifnhehfevptlksragtnvdcenltrvlkqldfevtvykdcryk dilrtieysasqnhsdsdcilvailshgemgyiyakdtqykldniwsfftanhcpslagk pklffiqacqgdrldggvtmqrsqtetdgdssmsykipvhadfliaystvpgfyswrntt rgswfmqslcaelaangkrldiltlltfvcqrvavdfesctpdtpemhqqkqipcittml trilrfsdkq
>d3sird_ c.17.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aaeynmrhknrgmalifnhnvdcenltrvlkqldfevtvykdkdilrtieysasqnhsds dcilvailsiwsfftanhcpslagkpklffiqaadfliaystvpgfyswrnttrgswfmq slcaelaangkrldiltlltfvcqrvavdfqipcittmltrilrfsdkq
Timeline for d3sird_: