Lineage for d3sfia2 (3sfi A:95-214)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502122Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1502123Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1502124Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1502402Protein automated matches [226970] (3 species)
    not a true protein
  7. 1502416Species Mycobacterium tuberculosis [TaxId:1773] [232226] (8 PDB entries)
  8. 1502424Domain d3sfia2: 3sfi A:95-214 [238508]
    Other proteins in same PDB: d3sfia1
    automated match to d3g1ma2
    protein/DNA complex; complexed with 3sf

Details for d3sfia2

PDB Entry: 3sfi (more details), 2.31 Å

PDB Description: ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.
PDB Compounds: (A:) Transcriptional regulatory repressor protein (TETR-family)

SCOPe Domain Sequences for d3sfia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfia2 a.121.1.1 (A:95-214) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d3sfia2:

Click to download the PDB-style file with coordinates for d3sfia2.
(The format of our PDB-style files is described here.)

Timeline for d3sfia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sfia1