Lineage for d3sd9a_ (3sd9 A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein automated matches [190079] (12 species)
not a true protein
Species Serratia fonticola [TaxId:47917] [196325] (3 PDB entries) 
Domain d3sd9a_: 3sd9 A: [200613]
automated match to d3sd9b_
complexed with zn
Details for d3sd9a_
PDB Entry: 3sd9 (more details), 1.83 Å
PDB Description: Crystal structure of serratia fonticola SFH-I: Source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d3sd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sd9a_ d.157.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]}
knltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplp
inevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnlek
slpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanr
teypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekapk
SCOPe Domain Coordinates for d3sd9a_:
Click to download the PDB-style file with coordinates for d3sd9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3sd9a_:
- d3sd9a_ first appeared in SCOPe 2.03
- d3sd9a_ appears in SCOPe 2.06
- d3sd9a_ appears in the current release, SCOPe 2.08
View in 3D
