Lineage for d3sd0b_ (3sd0 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434708Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 1434709Species Human (Homo sapiens) [TaxId:9606] [69824] (30 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 1434744Domain d3sd0b_: 3sd0 B: [196271]
    automated match to d1gngb_
    complexed with epe, tsk; mutant

Details for d3sd0b_

PDB Entry: 3sd0 (more details), 2.7 Å

PDB Description: Identification of a Glycogen Synthase Kinase-3b Inhibitor that Attenuates Hyperactivity in CLOCK Mutant Mice
PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d3sd0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sd0b_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

SCOPe Domain Coordinates for d3sd0b_:

Click to download the PDB-style file with coordinates for d3sd0b_.
(The format of our PDB-style files is described here.)

Timeline for d3sd0b_: