Lineage for d3sbtb2 (3sbt B:171-317)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727612Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2727613Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins)
  6. 2727614Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. 2727615Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (158 PDB entries)
  8. 2727624Domain d3sbtb2: 3sbt B:171-317 [343864]
    Other proteins in same PDB: d3sbta1, d3sbta2, d3sbtb1
    automated match to d3sbsa2
    complexed with pgo, so4

Details for d3sbtb2

PDB Entry: 3sbt (more details), 1.8 Å

PDB Description: Crystal structure of a Aar2-Prp8 complex
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d3sbtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbtb2 a.118.29.1 (B:171-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafln
amffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervwn
iclyssfqknslhntekimenkypell

SCOPe Domain Coordinates for d3sbtb2:

Click to download the PDB-style file with coordinates for d3sbtb2.
(The format of our PDB-style files is described here.)

Timeline for d3sbtb2:

2727624
d3sbtb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3sbtb1