Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) C-terminal part of Pfam PF05282 Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology |
Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins) |
Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (158 PDB entries) |
Domain d3sbtb2: 3sbt B:171-317 [343864] Other proteins in same PDB: d3sbta1, d3sbta2, d3sbtb1 automated match to d3sbsa2 complexed with pgo, so4 |
PDB Entry: 3sbt (more details), 1.8 Å
SCOPe Domain Sequences for d3sbtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbtb2 a.118.29.1 (B:171-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} dpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafln amffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervwn iclyssfqknslhntekimenkypell
Timeline for d3sbtb2: