Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Daboia russellii [TaxId:343250] [196182] (3 PDB entries) |
Domain d3s9ba_: 3s9b A: [196183] automated match to d2aiqa_ complexed with nag |
PDB Entry: 3s9b (more details), 1.9 Å
SCOPe Domain Sequences for d3s9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s9ba_ b.47.1.2 (A:) automated matches {Daboia russellii [TaxId: 343250]} vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp
Timeline for d3s9ba_: