Lineage for d3s8qb_ (3s8q B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087509Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1087510Protein automated matches [190907] (2 species)
    not a true protein
  7. 1087511Species Enterobacter sp. [TaxId:211595] [189872] (4 PDB entries)
  8. 1087516Domain d3s8qb_: 3s8q B: [185317]
    automated match to d2b5ad1
    protein/DNA complex

Details for d3s8qb_

PDB Entry: 3s8q (more details), 2.1 Å

PDB Description: Crystal structure of the R-M controller protein C.Esp1396I OL operator complex
PDB Compounds: (B:) r-m controller protein

SCOPe Domain Sequences for d3s8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s8qb_ a.35.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 211595]}
sfllskvsfvikkirlekgmtqedlayksnldrtyisgiernsrnltikslelimkglev
sdvvffemlikeilkhd

SCOPe Domain Coordinates for d3s8qb_:

Click to download the PDB-style file with coordinates for d3s8qb_.
(The format of our PDB-style files is described here.)

Timeline for d3s8qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3s8qa_