| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (55 species) not a true protein |
| Species Pseudomonas syringae [TaxId:323] [189694] (1 PDB entry) |
| Domain d3s6je_: 3s6j E: [185295] automated match to d2hdoa1 complexed with ca |
PDB Entry: 3s6j (more details), 2.2 Å
SCOPe Domain Sequences for d3s6je_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s6je_ c.108.1.0 (E:) automated matches {Pseudomonas syringae [TaxId: 323]}
pqtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretg
msitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatin
lkalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrck
atgvgllsggydigeleragalrvyedpldllnhldeias
Timeline for d3s6je_: