Class a: All alpha proteins [46456] (289 folds) |
Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
Superfamily a.265.1: Fic-like [140931] (1 family) |
Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
Protein automated matches [191277] (3 species) not a true protein |
Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries) |
Domain d3s6aa_: 3s6a A: [185293] automated match to d2g03a1 complexed with anp |
PDB Entry: 3s6a (more details), 2.2 Å
SCOPe Domain Sequences for d3s6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s6aa_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 491]} ksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfr fanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkk vvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyegye
Timeline for d3s6aa_: