Lineage for d3s6aa_ (3s6a A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020542Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2020543Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2020544Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2020552Protein automated matches [191277] (3 species)
    not a true protein
  7. 2020557Species Neisseria meningitidis [TaxId:491] [189879] (5 PDB entries)
  8. 2020563Domain d3s6aa_: 3s6a A: [185293]
    automated match to d2g03a1
    complexed with anp

Details for d3s6aa_

PDB Entry: 3s6a (more details), 2.2 Å

PDB Description: fic protein from neisseria meningitidis in complex with amppnp
PDB Compounds: (A:) Cell filamentation protein Fic-related protein

SCOPe Domain Sequences for d3s6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s6aa_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 491]}
ksideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfr
fanamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkk
vvnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyegye

SCOPe Domain Coordinates for d3s6aa_:

Click to download the PDB-style file with coordinates for d3s6aa_.
(The format of our PDB-style files is described here.)

Timeline for d3s6aa_: