Lineage for d3s3fb1 (3s3f B:24-305)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875770Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226240] (2 PDB entries)
  8. 2875774Domain d3s3fb1: 3s3f B:24-305 [216193]
    Other proteins in same PDB: d3s3fa2, d3s3fb2
    automated match to d2h04a_
    complexed with 1bo, bu1, ipa, vo4

Details for d3s3fb1

PDB Entry: 3s3f (more details), 2.7 Å

PDB Description: Crystal Structure of the catalytic domain of PTP10D from Drosophila melanogaster with a small molecule inhibitor Vanadate
PDB Compounds: (B:) Tyrosine-protein phosphatase 10D

SCOPe Domain Sequences for d3s3fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s3fb1 c.45.1.0 (B:24-305) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rpiliknfaehyrlmsadsdfrfseefeelkhvgrdqpctfadlpcnrpknrftnilpyd
hsrfklqpvdddegsdyinanyvpghnsprefivtqgplhstrddfwrmcwesnsraivm
ltrcfekgrekcdqywpndtvpvfygdikvqilndshyadwvmtefmlcrgseqrilrhf
hfttwpdfgvpnppqtlvrfvrafrdrigaeqrpivvhcsagvgrsgtfitldrilqqin
tsdyvdifgivyamrkervwmvqteqqyicihqcllavlegk

SCOPe Domain Coordinates for d3s3fb1:

Click to download the PDB-style file with coordinates for d3s3fb1.
(The format of our PDB-style files is described here.)

Timeline for d3s3fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s3fb2