Lineage for d3s1da1 (3s1d A:33-245)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) 
Family d.145.1.0: automated matches [191624] (1 protein)
not a true familyProtein automated matches [191143] (7 species)
not a true protein
Species Maize (Zea mays) [TaxId:4577] [225479] (14 PDB entries) 
Domain d3s1da1: 3s1d A:33-245 [216157]
Other proteins in same PDB: d3s1da2
automated match to d1w1oa2
complexed with fad, gol, nag, peg, zir; mutant
Details for d3s1da1
PDB Entry: 3s1d (more details), 1.75 Å
PDB Description: glu381ser mutant of maize cytokinin oxidase/dehydrogenase complexed with n6-isopentenyladenosine
PDB Compounds: (A:) cytokinin dehydrogenase 1SCOPe Domain Sequences for d3s1da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1da1 d.145.1.0 (A:33-245) automated matches {Maize (Zea mays) [TaxId: 4577]}
pwpaslaalaldgklrtdsnataaastdfgnitsalpaavlypsstadlvallsaanstp
gwpytiafrgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwid
vlraslargvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvt
cskqlnadlfdavlgglgqfgvitrariavepa
SCOPe Domain Coordinates for d3s1da1:
Click to download the PDB-style file with coordinates for d3s1da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3s1da1:
- d3s1da1 first appeared in SCOPe 2.03
- d3s1da1 appears in SCOPe 2.04
- d3s1da1 appears in SCOPe 2.06
- d3s1da1 appears in the current release, SCOPe 2.08
View in 3D
