Lineage for d3rvya_ (3rvy A:)
- Root: SCOPe 2.06
Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) 
Fold f.14: Gated ion channels [81325] (2 superfamilies)
oligomeric transmembrane alpha-helical proteinsSuperfamily f.14.1: Voltage-gated ion channels [81324] (3 families) 
Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (3 proteins)
Pfam PF08016Protein NavAb sodium channel [310744] (1 species) Species Arcobacter butzleri [TaxId:367737] [310997] (3 PDB entries) 
Domain d3rvya_: 3rvy A: [306481]
automated match to d3rvza_
complexed with px4
Details for d3rvya_
PDB Entry: 3rvy (more details), 2.7 Å
PDB Description: Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.7 A)
PDB Compounds: (A:) Ion transport proteinSCOPe Domain Sequences for d3rvya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rvya_ f.14.1.2 (A:) NavAb sodium channel {Arcobacter butzleri [TaxId: 367737]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaicvdam
SCOPe Domain Coordinates for d3rvya_:
Click to download the PDB-style file with coordinates for d3rvya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rvya_:
- d3rvya_ is new in SCOPe 2.06-stable
- d3rvya_ appears in SCOPe 2.07
- d3rvya_ appears in the current release, SCOPe 2.08
View in 3D
