Lineage for d3ruua_ (3ruu A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2341421Protein Bile acid receptor FXR [101433] (2 species)
  7. 2341422Species Human (Homo sapiens) [TaxId:9606] [101434] (8 PDB entries)
  8. 2341427Domain d3ruua_: 3ruu A: [185192]
    automated match to d1osha_
    complexed with 37g, so4

Details for d3ruua_

PDB Entry: 3ruu (more details), 2.5 Å

PDB Description: fxr with src1 and gsk237
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3ruua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ruua_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d3ruua_:

Click to download the PDB-style file with coordinates for d3ruua_.
(The format of our PDB-style files is described here.)

Timeline for d3ruua_: