Lineage for d3rt3c_ (3rt3 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. Protein automated matches [190929] (3 species)
    not a true protein
  7. 1482356Species Influenza b virus [TaxId:107412] [193690] (3 PDB entries)
  8. 1482357Domain d3rt3c_: 3rt3 C: [193691]
    Other proteins in same PDB: d3rt3b1, d3rt3b2
    automated match to d1xeqa1
    complexed with sin

Details for d3rt3c_

PDB Entry: 3rt3 (more details), 2.01 Å

PDB Description: complex of influenza virus protein with host anti-viral factor
PDB Compounds: (C:) Non-structural protein 1

SCOPe Domain Sequences for d3rt3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rt3c_ a.16.1.1 (C:) automated matches {Influenza b virus [TaxId: 107412]}
qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
nkrmsleerkaigvkmmkvllfmdpsagiegfep

SCOPe Domain Coordinates for d3rt3c_:

Click to download the PDB-style file with coordinates for d3rt3c_.
(The format of our PDB-style files is described here.)

Timeline for d3rt3c_: