Lineage for d3rrvb_ (3rrv B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836450Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)
  8. 1836461Domain d3rrvb_: 3rrv B: [233492]
    automated match to d2ej5a_
    complexed with ca, cl, edo

Details for d3rrvb_

PDB Entry: 3rrv (more details), 2.45 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis
PDB Compounds: (B:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3rrvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrvb_ c.14.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 1770]}
vydmpteidvradgalriitlnrpdslnsvnddlhvglarlwqrltddptaraavitgag
rafsaggdfgylkelsadadlraktirdgreivlgmarcripvvaavngpavglgcslva
lsdivyiaenayladphvqvglvaadggpltwplhislllakeyaltgtrisaqravelg
lanhvaddpvaeaiacakkilelpqqavestkrvlnihleravlasldyalsaesqsfvt
edfrsivtkladkn

SCOPe Domain Coordinates for d3rrvb_:

Click to download the PDB-style file with coordinates for d3rrvb_.
(The format of our PDB-style files is described here.)

Timeline for d3rrvb_: