Class a: All alpha proteins [46456] (284 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
Protein automated matches [190621] (10 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [226126] (1 PDB entry) |
Domain d3rrpa_: 3rrp A: [216025] automated match to d1vdka_ complexed with edo, lmr |
PDB Entry: 3rrp (more details), 2.3 Å
SCOPe Domain Sequences for d3rrpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rrpa_ a.127.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]} seqqyriehdtmgevrvpaealwraqtqravenfpisgrglertqiralgllkgacaqvn kdlgllaaekadaiiaaaqeiadgkhddqfpidvfqtgsgtssnmnaneviasiaaqatp pvvvhpnddvnmsqssndtfptathlaateaavrdlipaleylqqalatkakawktvvks grthlmdavpvtlgqefggyarqieagiervkatlprlgelpiggtavgtglnapdgfga kvvevlkqstglselktasdsfeaqaardglvegsgalktiaasltkiandirwmgsgpl tglgeiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaitvgglsgafelnvyip vmarnllesftllanvsrlfvdkcvdglvanedhlrtlaesspsivtplnsaigyeeaaa vakealkerktirqtvidrgligdklsieeldkrldvlamakvkd
Timeline for d3rrpa_: