Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins) automatically mapped to Pfam PF01256 |
Protein automated matches [193682] (1 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [193683] (9 PDB entries) |
Domain d3rpha_: 3rph A: [193684] automated match to d1kyha_ complexed with amp, mg, po4 |
PDB Entry: 3rph (more details), 1.75 Å
SCOPe Domain Sequences for d3rpha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rpha_ c.72.1.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} amnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklv igtsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvl tadcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaql qtvivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlna vylhgacaelwtdehsahtllahelsdilprvwkrfe
Timeline for d3rpha_: