Lineage for d3riia_ (3rii A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheetFamily d.3.1.0: automated matches [191342] (1 protein)
not a true familyProtein automated matches [190230] (23 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries) 
Domain d3riia_: 3rii A: [184984]
automated match to d1ucha_
complexed with edo, mg
Details for d3riia_
PDB Entry: 3rii (more details), 2 Å
PDB Description: Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase isozyme L5SCOPe Domain Sequences for d3riia_:
Sequence, based on SEQRES records: (download)
>d3riia_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepa
gsvvqdsrldtiffakqvinnasatqaivsvllncthqdvhlgetlsefkefsqsfdaam
kglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrlyeldglregp
idlgacnqddwisavrpviekriqkysegeirfnlmaivsdr
Sequence, based on observed residues (ATOM records): (download)
>d3riia_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepa
gsvvqdsrldtiffakqvinnasatqaivsvllncthqdvhlgetlsefkefsqsfdaam
kglalsnsdvirqvhnsfarqakeedafhfvsyvpvngrlyeldglregpidlgacnqdd
wisavrpviekriqkysegeirfnlmaivsdr
SCOPe Domain Coordinates for d3riia_:
Click to download the PDB-style file with coordinates for d3riia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3riia_:
- d3riia_ first appeared in SCOPe 2.01
- d3riia_ appears in SCOPe 2.07
View in 3D
