Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries) |
Domain d3rhcb_: 3rhc B: [196345] automated match to d3fz9a_ complexed with fes, gsh |
PDB Entry: 3rhc (more details), 2.4 Å
SCOPe Domain Sequences for d3rhcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rhcb_ c.47.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} srmeesirktvtentvviysktwcsyctevktlfkrlgvqplvveldqlgpqgpqlqkvl erltgqhtvpnvfvcgkhiggctdtvklnrkgdlelmlae
Timeline for d3rhcb_: