Lineage for d3rgws_ (3rgw S:)
- Root: SCOPe 2.05
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) 
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
2 domains: (1) alpa/beta; (2) Fe-S cluster-boundSuperfamily e.19.1: HydA/Nqo6-like [56770] (3 families) 
Family e.19.1.0: automated matches [191636] (1 protein)
not a true familyProtein automated matches [191172] (5 species)
not a true protein
Species Ralstonia eutropha [TaxId:381666] [256057] (5 PDB entries) 
Domain d3rgws_: 3rgw S: [239695]
Other proteins in same PDB: d3rgwl_
automated match to d3ayxb_
complexed with f3s, f4s, mg, nfu, sf4
Details for d3rgws_
PDB Entry: 3rgw (more details), 1.5 Å
PDB Description: Crystal structure at 1.5 A resolution of an H2-reduced, O2-tolerant hydrogenase from Ralstonia eutropha unmasks a novel iron-sulfur cluster
PDB Compounds: (S:) Membrane-bound hydrogenase (NIFE) small subunit HOXKSCOPe Domain Sequences for d3rgws_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgws_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]}
prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim
tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa
kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq
rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq
sghgcigcsedgfwdkgsfydrltgisqfg
SCOPe Domain Coordinates for d3rgws_:
Click to download the PDB-style file with coordinates for d3rgws_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rgws_:
- d3rgws_ first appeared in SCOPe 2.04
- d3rgws_ appears in SCOPe 2.06
- d3rgws_ appears in the current release, SCOPe 2.08
View in 3D
