![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
![]() | Protein automated matches [191172] (5 species) not a true protein |
![]() | Species Ralstonia eutropha [TaxId:381666] [256057] (5 PDB entries) |
![]() | Domain d3rgws_: 3rgw S: [239695] Other proteins in same PDB: d3rgwl_ automated match to d3ayxb_ complexed with f3s, f4s, mg, nfu, sf4 |
PDB Entry: 3rgw (more details), 1.5 Å
SCOPe Domain Sequences for d3rgws_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgws_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]} prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq sghgcigcsedgfwdkgsfydrltgisqfg
Timeline for d3rgws_: