Lineage for d3rfca2 (3rfc A:140-364)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamiliesSuperfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) 
Family d.142.1.0: automated matches [227184] (1 protein)
not a true familyProtein automated matches [226904] (18 species)
not a true protein
Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries) 
Domain d3rfca2: 3rfc A:140-364 [215789]
Other proteins in same PDB: d3rfca1
automated match to d1ehia2
complexed with adp, mg
Details for d3rfca2
PDB Entry: 3rfc (more details), 2.1 Å
PDB Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP
PDB Compounds: (A:) D-alanine--D-alanine ligase 1SCOPe Domain Sequences for d3rfca2:
Sequence, based on SEQRES records: (download)
>d3rfca2 d.142.1.0 (A:140-364) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqllrsav
Sequence, based on observed residues (ATOM records): (download)
>d3rfca2 d.142.1.0 (A:140-364) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqllrsav
SCOPe Domain Coordinates for d3rfca2:
Click to download the PDB-style file with coordinates for d3rfca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rfca2:
- d3rfca2 is new in SCOPe 2.03-stable
- d3rfca2 appears in SCOPe 2.04
- d3rfca2 appears in the current release, SCOPe 2.08
View in 3D
