Lineage for d3re3a_ (3re3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914817Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1914936Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 1914937Protein automated matches [190884] (7 species)
    not a true protein
  7. 1915001Species Francisella tularensis [TaxId:177416] [189938] (1 PDB entry)
  8. 1915002Domain d3re3a_: 3re3 A: [184896]
    automated match to d1jn1a_
    complexed with cl, mpd, na, po4, pop

Details for d3re3a_

PDB Entry: 3re3 (more details), 2.65 Å

PDB Description: Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis
PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3re3a_:

Sequence, based on SEQRES records: (download)

>d3re3a_ d.79.5.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
namsfrighgydvhkftsakqniiiggveiayhlgleahsdgdvlihalcdailgalglg
digkhfldtdnqfknidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmrac
lanileiqisqinikattterlgfigreegiathvvcllyr

Sequence, based on observed residues (ATOM records): (download)

>d3re3a_ d.79.5.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
namsfrighgydvhkftsakqniiiggveiayhldgdvlihalcdailgalglgdigkhf
knidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmraclanileiqisqin
ikattterlgfigreegiathvvcllyr

SCOPe Domain Coordinates for d3re3a_:

Click to download the PDB-style file with coordinates for d3re3a_.
(The format of our PDB-style files is described here.)

Timeline for d3re3a_: