Lineage for d3rd1b_ (3rd1 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (27 species)
not a true protein
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [196360] (1 PDB entry) 
Domain d3rd1b_: 3rd1 B: [196361]
automated match to d3aq4a_
complexed with gdp, mg
Details for d3rd1b_
PDB Entry: 3rd1 (more details), 1.8 Å
PDB Description: structure of an adp ribosylation factor from entamoeba histolytica hm- 1:imss bound to mg-gdp
PDB Compounds: (B:) ADP-ribosylation factorSCOPe Domain Sequences for d3rd1b_:
Sequence, based on SEQRES records: (download)
>d3rd1b_ c.37.1.8 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfan
khdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnl
Sequence, based on observed residues (ATOM records): (download)
>d3rd1b_ c.37.1.8 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlpqamsis
evteklglqtiknrkwycqtscatngdglyegldwladnl
SCOPe Domain Coordinates for d3rd1b_:
Click to download the PDB-style file with coordinates for d3rd1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rd1b_:
- d3rd1b_ first appeared in SCOPe 2.02
- d3rd1b_ appears in SCOPe 2.04
- d3rd1b_ does not appear in SCOPe 2.06
View in 3D
