Lineage for d3r8rp_ (3r8r P:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098435Species Bacillus subtilis [TaxId:1423] [193173] (1 PDB entry)
  8. 2098450Domain d3r8rp_: 3r8r P: [193174]
    automated match to d1vpxe_
    complexed with gol, so4

Details for d3r8rp_

PDB Entry: 3r8r (more details), 1.9 Å

PDB Description: transaldolase from bacillus subtilis
PDB Compounds: (P:) Transaldolase

SCOPe Domain Sequences for d3r8rp_:

Sequence, based on SEQRES records: (download)

>d3r8rp_ c.1.10.0 (P:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlffvdtanideireanelgilagvttnpslvakeanvsfhdrlreitdvvkgsvsaevi
slkaeemieegkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaa
ragatyvspflgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrga
higtmplkvihaltkhpltdkgieqfladwnk

Sequence, based on observed residues (ATOM records): (download)

>d3r8rp_ c.1.10.0 (P:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlffvdtanideireanelgilagvttnsfhdrlreitdvvkgsvsaevislkaeemiee
gkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaaragatyvspf
lgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrgahigtmplkvi
haltkhpltdkgieqfladwnk

SCOPe Domain Coordinates for d3r8rp_:

Click to download the PDB-style file with coordinates for d3r8rp_.
(The format of our PDB-style files is described here.)

Timeline for d3r8rp_: