Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries) |
Domain d3r66c2: 3r66 C:79-154 [233411] Other proteins in same PDB: d3r66a_, d3r66b_, d3r66c1, d3r66d1 automated match to d1z2ma2 |
PDB Entry: 3r66 (more details), 2.3 Å
SCOPe Domain Sequences for d3r66c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r66c2 d.15.1.1 (C:79-154) automated matches {Human (Homo sapiens) [TaxId: 9606]} deplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg eyglkplstvfmnlrl
Timeline for d3r66c2:
View in 3D Domains from other chains: (mouse over for more information) d3r66a_, d3r66b_, d3r66d1, d3r66d2 |