Lineage for d3r4sb1 (3r4s B:867-1093)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390422Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2390430Domain d3r4sb1: 3r4s B:867-1093 [233389]
    Other proteins in same PDB: d3r4sa2, d3r4sa3, d3r4sb2, d3r4sb3
    automated match to d3btaa1
    complexed with sia, slb

Details for d3r4sb1

PDB Entry: 3r4s (more details), 2.15 Å

PDB Description: cell entry of botulinum neurotoxin type c is dependent upon interaction with two ganglioside molecules
PDB Compounds: (B:) Botulinum neurotoxin type C1

SCOPe Domain Sequences for d3r4sb1:

Sequence, based on SEQRES records: (download)

>d3r4sb1 b.29.1.0 (B:867-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
nindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtqn
enivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqned
seqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskti
tfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslq

Sequence, based on observed residues (ATOM records): (download)

>d3r4sb1 b.29.1.0 (B:867-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
nindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtqn
enivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqned
seqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskti
tfeinkipdtgdsdninmwirdfyifakeldgkdinilfnslq

SCOPe Domain Coordinates for d3r4sb1:

Click to download the PDB-style file with coordinates for d3r4sb1.
(The format of our PDB-style files is described here.)

Timeline for d3r4sb1: