Lineage for d3r4sb1 (3r4s B:864-1093)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.0: automated matches [191363] (1 protein)
not a true familyProtein automated matches [190437] (29 species)
not a true protein
Species Clostridium botulinum [TaxId:1491] [225675] (19 PDB entries) 
Domain d3r4sb1: 3r4s B:864-1093 [233389]
Other proteins in same PDB: d3r4sa2, d3r4sb2
automated match to d3btaa1
complexed with sia, slb
Details for d3r4sb1
PDB Entry: 3r4s (more details), 2.15 Å
PDB Description: cell entry of botulinum neurotoxin type c is dependent upon interaction with two ganglioside molecules
PDB Compounds: (B:) Botulinum neurotoxin type C1SCOPe Domain Sequences for d3r4sb1:
Sequence, based on SEQRES records: (download)
>d3r4sb1 b.29.1.0 (B:864-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
ktitfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslq
Sequence, based on observed residues (ATOM records): (download)
>d3r4sb1 b.29.1.0 (B:864-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
ktitfeinkipdtgdsdninmwirdfyifakeldgkdinilfnslq
SCOPe Domain Coordinates for d3r4sb1:
Click to download the PDB-style file with coordinates for d3r4sb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3r4sb1:
- d3r4sb1 first appeared in SCOPe 2.03
- d3r4sb1 appears in SCOPe 2.05
- d3r4sb1 appears in the current release, SCOPe 2.08
View in 3D
