Lineage for d3r41b_ (3r41 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153425Species Rhodopseudomonas palustris [TaxId:1076] [267879] (9 PDB entries)
  8. 2153429Domain d3r41b_: 3r41 B: [265311]
    Other proteins in same PDB: d3r41a2
    automated match to d3qyja_
    complexed with ca, cl

Details for d3r41b_

PDB Entry: 3r41 (more details), 1.05 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - His280Asn/apo
PDB Compounds: (B:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3r41b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r41b_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d3r41b_:

Click to download the PDB-style file with coordinates for d3r41b_.
(The format of our PDB-style files is described here.)

Timeline for d3r41b_: