Lineage for d3r0ea_ (3r0e A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806095Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 1806096Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 1806148Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 1806149Protein automated matches [190587] (7 species)
    not a true protein
  7. 1806190Species Remusatia vivipara [TaxId:189456] [193663] (1 PDB entry)
  8. 1806191Domain d3r0ea_: 3r0e A: [197432]
    automated match to d3r0ed_

Details for d3r0ea_

PDB Entry: 3r0e (more details), 2.4 Å

PDB Description: Structure of Remusatia vivipara lectin
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3r0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0ea_ b.78.1.0 (A:) automated matches {Remusatia vivipara [TaxId: 189456]}
lgtnyllsgqtldteghlkngdfdlvmqddcnlvlyngnwqsntanngrdckltltdyge
lvikngdgstvwksgaqsvkgnyaavvhpdgrlvvfgpsvfkidpwvrg

SCOPe Domain Coordinates for d3r0ea_:

Click to download the PDB-style file with coordinates for d3r0ea_.
(The format of our PDB-style files is described here.)

Timeline for d3r0ea_: