| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Rhodospirillum rubrum [TaxId:269796] [189854] (1 PDB entry) |
| Domain d3r03a_: 3r03 A: [184751] automated match to d1muta_ complexed with adp |
PDB Entry: 3r03 (more details), 2.49 Å
SCOPe Domain Sequences for d3r03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r03a_ d.113.1.0 (A:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
pillvtaaalidpdgrvllaqrppgkslaglwefpggklepgetpeaalvrelaeelgvd
trasclaplafashsydtfhllmplyacrswrgrataregqtlawvraerlreypmppad
lplipilqdwl
Timeline for d3r03a_: