Lineage for d3qy4a_ (3qy4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2531389Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2532723Protein automated matches [190299] (8 species)
    not a true protein
  7. 2532724Species Chicken (Gallus gallus) [TaxId:9031] [196365] (37 PDB entries)
  8. 2532730Domain d3qy4a_: 3qy4 A: [196366]
    automated match to d2vb1a1

Details for d3qy4a_

PDB Entry: 3qy4 (more details), 1.65 Å

PDB Description: Crystallization and in situ data collection of Lysozyme using the Crystal Former
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d3qy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qy4a_ d.2.1.2 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgssnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcra

SCOPe Domain Coordinates for d3qy4a_:

Click to download the PDB-style file with coordinates for d3qy4a_.
(The format of our PDB-style files is described here.)

Timeline for d3qy4a_: