Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.2: UBX domain [54250] (6 proteins) Pfam PF00789 |
Protein automated matches [191298] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries) |
Domain d3qx1a_: 3qx1 A: [195453] automated match to d1h8ca_ complexed with so4 |
PDB Entry: 3qx1 (more details), 1.6 Å
SCOPe Domain Sequences for d3qx1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qx1a_ d.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp nksllevklfpqetlfleake
Timeline for d3qx1a_: