Lineage for d3qvqd_ (3qvq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839967Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2839968Protein automated matches [190919] (11 species)
    not a true protein
  7. 2839982Species Oleispira antarctica [TaxId:188908] [196362] (1 PDB entry)
  8. 2839986Domain d3qvqd_: 3qvq D: [196363]
    automated match to d2pz0b_
    complexed with cl, edo, g3p, mg, na, ni, peg

Details for d3qvqd_

PDB Entry: 3qvq (more details), 1.6 Å

PDB Description: the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate
PDB Compounds: (D:) Phosphodiesterase Olei02445

SCOPe Domain Sequences for d3qvqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvqd_ c.1.18.0 (D:) automated matches {Oleispira antarctica [TaxId: 188908]}
qsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddyls
rttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkpce
gleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawqer
lehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdypqk
iqsaids

SCOPe Domain Coordinates for d3qvqd_:

Click to download the PDB-style file with coordinates for d3qvqd_.
(The format of our PDB-style files is described here.)

Timeline for d3qvqd_: