![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (30 species) not a true protein |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [226298] (2 PDB entries) |
![]() | Domain d3qvna2: 3qvn A:90-205 [215452] Other proteins in same PDB: d3qvna1 automated match to d1kkca2 complexed with mn |
PDB Entry: 3qvn (more details), 2.6 Å
SCOPe Domain Sequences for d3qvna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvna2 d.44.1.0 (A:90-205) automated matches {Yeast (Candida albicans) [TaxId: 5476]} vskgggkhpdtssalgkqivaqygsvsnliditnsklagiqgsgwafivknkqnggaldv vttanqdtisaphlvpiiaidawehayylqyqnvkldyfkaiwnvinwaeaesrys
Timeline for d3qvna2: