| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
| Protein automated matches [190651] (8 species) not a true protein |
| Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry) |
| Domain d3qvad_: 3qva D: [196216] Other proteins in same PDB: d3qvaa2, d3qvab2 automated match to d2igla_ complexed with po4 |
PDB Entry: 3qva (more details), 1.76 Å
SCOPe Domain Sequences for d3qvad_:
Sequence, based on SEQRES records: (download)
>d3qvad_ b.3.4.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
stlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltaet
gawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrgs
>d3qvad_ b.3.4.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
stlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltaet
gawfaragresvftraqidfvigdhfhlpfliapggwstyrgs
Timeline for d3qvad_: