Lineage for d3quia_ (3qui A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787114Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2787115Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2787123Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 2787161Domain d3quia_: 3qui A: [200387]
    automated match to d1u1te_
    protein/RNA complex; complexed with ade, adp, anp, peg

Details for d3quia_

PDB Entry: 3qui (more details), 1.93 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa Hfq in complex with ADPNP
PDB Compounds: (A:) Protein hfq

SCOPe Domain Sequences for d3quia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quia_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
skghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaist
vvpsrpvrlps

SCOPe Domain Coordinates for d3quia_:

Click to download the PDB-style file with coordinates for d3quia_.
(The format of our PDB-style files is described here.)

Timeline for d3quia_: